Lineage for d3fuxc_ (3fux C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895070Species Thermus thermophilus HB8 [TaxId:300852] [225633] (5 PDB entries)
  8. 2895077Domain d3fuxc_: 3fux C: [210188]
    automated match to d3tpzb_
    protein/RNA complex; complexed with mta

Details for d3fuxc_

PDB Entry: 3fux (more details), 1.68 Å

PDB Description: t. thermophilus 16s rrna a1518 and a1519 methyltransferase (ksga) in complex with 5'-methylthioadenosine in space group p212121
PDB Compounds: (C:) Dimethyladenosine transferase

SCOPe Domain Sequences for d3fuxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fuxc_ c.66.1.0 (C:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
laspqsvrallerhglfadkrfgqnflvseahlrriveaarpftgpvfevgpglgaltra
lleagaevtaiekdlrlrpvleetlsglpvrlvfqdallypweevpqgsllvanlpyhia
tplvtrllktgrfarlvflvqkevaermtarpktpaygvltlrvahhavaerlfdlppga
ffpppkvwsslvrltptgalddpglfrlveaafgkrrktllnalaaagypkarveealra
lglpprvraeeldleafrrlregle

SCOPe Domain Coordinates for d3fuxc_:

Click to download the PDB-style file with coordinates for d3fuxc_.
(The format of our PDB-style files is described here.)

Timeline for d3fuxc_: