![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
![]() | Species Fab 1F7 (mouse), kappa L chain [49003] (1 PDB entry) |
![]() | Domain d1figl2: 1fig L:109-214 [21016] Other proteins in same PDB: d1figh1, d1figl1 |
PDB Entry: 1fig (more details), 3 Å
SCOP Domain Sequences for d1figl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1figl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab 1F7 (mouse), kappa L chain} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1figl2: