Lineage for d3fu9a3 (3fu9 A:344-559)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2770398Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2770399Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2771244Family b.6.1.3: Multidomain cupredoxins [49550] (15 proteins)
  6. 2771289Protein Laccase, C-terminal domain [418907] (5 species)
  7. 2771290Species Fungus (Melanocarpus albomyces) [TaxId:204285] [419309] (9 PDB entries)
  8. 2771303Domain d3fu9a3: 3fu9 A:344-559 [210145]
    Other proteins in same PDB: d3fu9a1, d3fu9a2, d3fu9b1, d3fu9b2
    automated match to d1gw0a3
    complexed with cl, cu, kib, nag, so4

    has additional insertions and/or extensions that are not grouped together

Details for d3fu9a3

PDB Entry: 3fu9 (more details), 2 Å

PDB Description: melanocarpus albomyces laccase crystal soaked (20 min) with 2,6- dimethoxyphenol
PDB Compounds: (A:) Laccase-1

SCOPe Domain Sequences for d3fu9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fu9a3 b.6.1.3 (A:344-559) Laccase, C-terminal domain {Fungus (Melanocarpus albomyces) [TaxId: 204285]}
rsvpvnsfvkrpdntlpvaldltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsd
nivqvdavdqwtywliendpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpav
dlarlngdnpprrdttmlpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpad
lrqrisqededdfnrvcdewraywptnpypkidsgl

SCOPe Domain Coordinates for d3fu9a3:

Click to download the PDB-style file with coordinates for d3fu9a3.
(The format of our PDB-style files is described here.)

Timeline for d3fu9a3: