Lineage for d2cgrl2 (2cgr L:113-219)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1103262Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1105902Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1108335Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (4 species)
  7. 1108556Species Mouse (Mus musculus) [TaxId:10090] [88567] (317 PDB entries)
    Uniprot P01837# KAC_MOUSE Ig kappa chain C region; 99% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01637 (Ig kappa chain V-V region T1) and Uniprot P01837 (Ig kappa chain C region) ! Uniprot P01837 # KAC_MOUSE Ig kappa chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01837 # ! KAC_MOUSE Ig kappa chain C region
  8. 1108694Domain d2cgrl2: 2cgr L:113-219 [21012]
    Other proteins in same PDB: d2cgrh1, d2cgrh2, d2cgrl1
    part of an anti-sweetener Fab
    complexed with gas

Details for d2cgrl2

PDB Entry: 2cgr (more details), 2.2 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab
PDB Compounds: (L:) igg2b-kappa nc6.8 fab (light chain)

SCOPe Domain Sequences for d2cgrl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgrl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOPe Domain Coordinates for d2cgrl2:

Click to download the PDB-style file with coordinates for d2cgrl2.
(The format of our PDB-style files is described here.)

Timeline for d2cgrl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cgrl1