Class b: All beta proteins [48724] (110 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species) |
Species Fab, anti-sweetener (mouse), kappa L chain [49002] (2 PDB entries) |
Domain d2cgrl2: 2cgr L:113-219 [21012] Other proteins in same PDB: d2cgrh1, d2cgrl1 |
PDB Entry: 2cgr (more details), 2.2 Å
SCOP Domain Sequences for d2cgrl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cgrl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d2cgrl2: