Lineage for d2cgrl2 (2cgr L:113-219)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9131Species Fab, anti-sweetener (mouse), kappa L chain [49002] (2 PDB entries)
  8. 9133Domain d2cgrl2: 2cgr L:113-219 [21012]
    Other proteins in same PDB: d2cgrh1, d2cgrl1

Details for d2cgrl2

PDB Entry: 2cgr (more details), 2.2 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d2cgrl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cgrl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2cgrl2:

Click to download the PDB-style file with coordinates for d2cgrl2.
(The format of our PDB-style files is described here.)

Timeline for d2cgrl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cgrl1