SCOP 1.55: Domain d2cgrl2: 2cgr L:113-219

Lineage for d2cgrl2 (2cgr L:113-219)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab, anti-sweetener (mouse), kappa L chain [49002] (2 PDB entries)

8. Domain d2cgrl2: 2cgr L:113-219 [21012]
   Other proteins in same PDB: d2cgrh1, d2cgrl1

Details for d2cgrl2

PDB Entry: 2cgr, 2.2 Å

PDB Description: local and transmitted conformational changes on complexation of an anti-sweetener fab

SCOP Domain Sequences for d2cgrl2:

Sequence; same for both SEQRES and ATOM records:

>d2cgrl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab, anti-sweetener (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2cgrl2:

• d2cgrl2 appears in SCOP 1.57
  
• d2cgrl2 appears in the current release, SCOPe 2.08