Lineage for d2vira2 (2vir A:111-210)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104235Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries)
  8. 104242Domain d2vira2: 2vir A:111-210 [21010]
    Other proteins in same PDB: d2vira1, d2virb1, d2virc_

Details for d2vira2

PDB Entry: 2vir (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d2vira2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vira2 b.1.1.2 (A:111-210) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d2vira2:

Click to download the PDB-style file with coordinates for d2vira2.
(The format of our PDB-style files is described here.)

Timeline for d2vira2: