Lineage for d3ftpb_ (3ftp B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2107274Species Burkholderia pseudomallei [TaxId:28450] [225606] (1 PDB entry)
  8. 2107276Domain d3ftpb_: 3ftp B: [210094]
    automated match to d1g0oa_

Details for d3ftpb_

PDB Entry: 3ftp (more details), 2.05 Å

PDB Description: Crystal structure of 3-Ketoacyl-(acyl-carrier-protein) reductase from Burkholderia pseudomallei at 2.05 A resolution
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d3ftpb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ftpb_ c.2.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
dktldkqvaivtgasrgigraialelarrgamvigtatteagaegigaafkqaglegrga
vlnvndatavdalvestlkefgalnvlvnnagitqdqlamrmkddewdavidtnlkavfr
lsravlrpmmkarggrivnitsvvgsagnpgqvnyaaakagvagmtralareigsrgitv
ncvapgfidtdmtkglpqeqqtalktqiplgrlgspediahavaflaspqagyitgttlh
vnggmfms

SCOPe Domain Coordinates for d3ftpb_:

Click to download the PDB-style file with coordinates for d3ftpb_.
(The format of our PDB-style files is described here.)

Timeline for d3ftpb_: