Lineage for d2vitb2 (2vit B:121-221)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453686Domain d2vitb2: 2vit B:121-221 [21009]
    Other proteins in same PDB: d2vita1, d2vita2, d2vitb1, d2vitc_
    part of Fab HC19

Details for d2vitb2

PDB Entry: 2vit (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2vitb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vitb2 b.1.1.2 (B:121-221) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d2vitb2:

Click to download the PDB-style file with coordinates for d2vitb2.
(The format of our PDB-style files is described here.)

Timeline for d2vitb2: