Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries) |
Domain d2vitb2: 2vit B:121-221 [21009] Other proteins in same PDB: d2vita1, d2vitb1, d2vitc_ complexed with zn; mutant |
PDB Entry: 2vit (more details), 3.25 Å
SCOP Domain Sequences for d2vitb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2vitb2 b.1.1.2 (B:121-221) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain} ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp
Timeline for d2vitb2: