Lineage for d3frcb2 (3frc B:86-211)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1998814Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1998815Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1998816Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1999415Protein Pf GST [101210] (1 species)
    cannot be assigned to any of the known GST classes
  7. 1999416Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [101211] (6 PDB entries)
  8. 1999420Domain d3frcb2: 3frc B:86-211 [210081]
    Other proteins in same PDB: d3frca1, d3frcb1
    automated match to d1okta1
    complexed with 0hg

Details for d3frcb2

PDB Entry: 3frc (more details), 2 Å

PDB Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
PDB Compounds: (B:) glutathione s-transferase

SCOPe Domain Sequences for d3frcb2:

Sequence, based on SEQRES records: (download)

>d3frcb2 a.45.1.1 (B:86-211) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

Sequence, based on observed residues (ATOM records): (download)

>d3frcb2 a.45.1.1 (B:86-211) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhnd
kyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitnrkes
vy

SCOPe Domain Coordinates for d3frcb2:

Click to download the PDB-style file with coordinates for d3frcb2.
(The format of our PDB-style files is described here.)

Timeline for d3frcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3frcb1