Lineage for d2vita2 (2vit A:111-210)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 656556Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)
  7. 656637Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
  8. 656660Domain d2vita2: 2vit A:111-210 [21008]
    Other proteins in same PDB: d2vita1, d2vitb1, d2vitb2, d2vitc_
    part of Fab HC19
    complexed with zn; mutant

Details for d2vita2

PDB Entry: 2vit (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, mutant with thr 155 replaced by ile, complexed with a neutralizing antibody
PDB Compounds: (A:) immunoglobulin (igg1, lambda)

SCOP Domain Sequences for d2vita2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2vita2 b.1.1.2 (A:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

SCOP Domain Coordinates for d2vita2:

Click to download the PDB-style file with coordinates for d2vita2.
(The format of our PDB-style files is described here.)

Timeline for d2vita2: