Lineage for d3frca1 (3frc A:5-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877253Protein Pf GST [102442] (1 species)
    cannot be assigned to any of the known GST classes
  7. 2877254Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [102443] (6 PDB entries)
  8. 2877255Domain d3frca1: 3frc A:5-85 [210078]
    Other proteins in same PDB: d3frca2, d3frcb2
    automated match to d1okta2
    complexed with 0hg

Details for d3frca1

PDB Entry: 3frc (more details), 2 Å

PDB Description: Tetramerization and Cooperativity in Plasmodium falciparum glutathione transferase are mediated by the atypic loop 113-118
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d3frca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3frca1 c.47.1.5 (A:5-85) Pf GST {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
ivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvpilqi
gdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d3frca1:

Click to download the PDB-style file with coordinates for d3frca1.
(The format of our PDB-style files is described here.)

Timeline for d3frca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3frca2