Lineage for d2visb2 (2vis B:121-221)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8970Species Fab HC19 (mouse), lambda L chain [49001] (4 PDB entries)
  8. 8974Domain d2visb2: 2vis B:121-221 [21007]
    Other proteins in same PDB: d2visa1, d2visb1, d2visc_

Details for d2visb2

PDB Entry: 2vis (more details), 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody

SCOP Domain Sequences for d2visb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2visb2 b.1.1.2 (B:121-221) Immunoglobulin (constant domains of L and H chains) {Fab HC19 (mouse), lambda L chain}
ssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlq
sdlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivp

SCOP Domain Coordinates for d2visb2:

Click to download the PDB-style file with coordinates for d2visb2.
(The format of our PDB-style files is described here.)

Timeline for d2visb2: