SCOP 1.75: Domain d2visa2: 2vis A:111-210

Lineage for d2visa2 (2vis A:111-210)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d2visa2: 2vis A:111-210 [21006]
   Other proteins in same PDB: d2visa1, d2visb1, d2visb2, d2visc_
   part of Fab HC19
   complexed with nag, zn; mutant

Details for d2visa2

PDB Entry: 2vis, 3.25 Å

PDB Description: influenza virus hemagglutinin, (escape) mutant with thr 131 replaced by ile, complexed with a neutralizing antibody

PDB Compounds: (A:) immunoglobulin (igg1, lambda)

SCOP Domain Sequences for d2visa2:

Sequence; same for both SEQRES and ATOM records:

>d2visa2 b.1.1.2 (A:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

Timeline for d2visa2:

• d2visa2 first appeared (with stable ids) in SCOP 1.55
  
• d2visa2 appears in SCOP 1.73
  
• d2visa2 appears in SCOPe 2.01
  
• d2visa2 appears in the current release, SCOPe 2.08