Class b: All beta proteins [48724] (176 folds) |
Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families) |
Family b.43.4.0: automated matches [227162] (1 protein) not a true family |
Protein automated matches [226870] (16 species) not a true protein |
Species Salmonella typhimurium [TaxId:99287] [225604] (1 PDB entry) |
Domain d3fpkb1: 3fpk B:2-100 [210042] Other proteins in same PDB: d3fpka2, d3fpkb2 automated match to d1fdra1 complexed with ca, fad, mg |
PDB Entry: 3fpk (more details), 1.7 Å
SCOPe Domain Sequences for d3fpkb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fpkb1 b.43.4.0 (B:2-100) automated matches {Salmonella typhimurium [TaxId: 99287]} adwvtgkvtkvqnwtdalfsltvhapinpftagqftklgleidgervqraysyvnapdnp nlefylvtvpqgklsprlaalkpgdevqvvsdasgffvl
Timeline for d3fpkb1: