SCOP 1.65: Domain d1gigl2: 1gig L:111-210

Lineage for d1gigl2 (1gig L:111-210)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (20 PDB entries)

8. Domain d1gigl2: 1gig L:111-210 [21004]
   Other proteins in same PDB: d1gigh1, d1gigh2, d1gigl1
   part of Fab HC19

Details for d1gigl2

PDB Entry: 1gig, 2.3 Å

PDB Description: refined three-dimensional structure of the fab fragment of a murine igg1, lambda antibody

SCOP Domain Sequences for d1gigl2:

Sequence; same for both SEQRES and ATOM records:

>d1gigl2 b.1.1.2 (L:111-210) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus)}
qpksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskq
snnkymassyltltarawerhssyscqvtheghtveksls

Timeline for d1gigl2:

• d1gigl2 first appeared (with stable ids) in SCOP 1.55
  
• d1gigl2 appears in SCOP 1.63
  
• d1gigl2 appears in SCOP 1.67
  
• d1gigl2 appears in the current release, SCOPe 2.08