Lineage for d3fo9h1 (3fo9 H:1-113)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1755448Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1755653Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1755910Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (63 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 1755937Domain d3fo9h1: 3fo9 H:1-113 [210030]
    Other proteins in same PDB: d3fo9a1, d3fo9a2, d3fo9b2, d3fo9h2, d3fo9l1, d3fo9l2
    automated match to d1axth1
    complexed with dik

Details for d3fo9h1

PDB Entry: 3fo9 (more details), 1.9 Å

PDB Description: crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
PDB Compounds: (H:) Immunoglobulin IGG2A - heavy chain

SCOPe Domain Sequences for d3fo9h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fo9h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evkleesggglvqpggsmklscvvsgltfsrfwmswvrqspekglewvaeirlksdnyat
hyaesvkgkftisrddsksrlylqmnslrtedtgiyyckiyfysfsywgqgtlvtvsa

SCOPe Domain Coordinates for d3fo9h1:

Click to download the PDB-style file with coordinates for d3fo9h1.
(The format of our PDB-style files is described here.)

Timeline for d3fo9h1: