Lineage for d6fabh2 (6fab H:122-222)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8718Species Fab 36-71 (mouse), kappa L chain [49000] (1 PDB entry)
  8. 8719Domain d6fabh2: 6fab H:122-222 [21003]
    Other proteins in same PDB: d6fabh1, d6fabl1

Details for d6fabh2

PDB Entry: 6fab (more details), 1.9 Å

PDB Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten

SCOP Domain Sequences for d6fabh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d6fabh2 b.1.1.2 (H:122-222) Immunoglobulin (constant domains of L and H chains) {Fab 36-71 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd

SCOP Domain Coordinates for d6fabh2:

Click to download the PDB-style file with coordinates for d6fabh2.
(The format of our PDB-style files is described here.)

Timeline for d6fabh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d6fabh1