Lineage for d3fo9a1 (3fo9 A:1-107)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1289963Protein automated matches [190119] (16 species)
    not a true protein
  7. 1290351Species Mouse (Mus musculus) [TaxId:10090] [186842] (99 PDB entries)
  8. 1290374Domain d3fo9a1: 3fo9 A:1-107 [210026]
    Other proteins in same PDB: d3fo9a2, d3fo9b1, d3fo9b2, d3fo9h1, d3fo9h2, d3fo9l2
    automated match to d1t66c1
    complexed with dik

Details for d3fo9a1

PDB Entry: 3fo9 (more details), 1.9 Å

PDB Description: crystal structure of aldolase antibody 33f12 fab' in complex with hapten 1,3-diketone
PDB Compounds: (A:) Immunoglobulin IGG2A - light chain

SCOPe Domain Sequences for d3fo9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fo9a1 b.1.1.1 (A:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
elvmtqtplslpvslgdqasiscrssqslvhsygntflnwylqksgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqgthvpytfgggtkleik

SCOPe Domain Coordinates for d3fo9a1:

Click to download the PDB-style file with coordinates for d3fo9a1.
(The format of our PDB-style files is described here.)

Timeline for d3fo9a1: