SCOP 1.63: Domain d6fabl2: 6fab L:109-214

Lineage for d6fabl2 (6fab L:109-214)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 36-71 (mouse), kappa L chain [49000] (2 PDB entries)

8. Domain d6fabl2: 6fab L:109-214 [21002]
   Other proteins in same PDB: d6fabh1, d6fabl1

Details for d6fabl2

PDB Entry: 6fab, 1.9 Å

PDB Description: three-dimensional structure of murine anti-p-azophenylarsonate fab 36-71. 1. x-ray crystallography, site-directed mutagenesis, and modeling of the complex with hapten

SCOP Domain Sequences for d6fabl2:

Sequence; same for both SEQRES and ATOM records:

>d6fabl2 b.1.1.2 (L:109-214) Immunoglobulin (constant domains of L and H chains) {Fab 36-71 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d6fabl2:

• d6fabl2 first appeared (with stable ids) in SCOP 1.55
  
• d6fabl2 appears in SCOP 1.61
  
• d6fabl2 appears in SCOP 1.65
  
• d6fabl2 appears in the current release, SCOPe 2.08