SCOPe 2.05: Domain d3fn0l1: 3fn0 L:3-107

Lineage for d3fn0l1 (3fn0 L:3-107)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3fn0l1: 3fn0 L:3-107 [210012]
   automated match to d1c5da1

Details for d3fn0l1

PDB Entry: 3fn0, 1.8 Å

PDB Description: Crystal structure of HIV-1 neutralizing human Fab Z13e1 in complex with a 12-residue peptide containing the Z13e1 epitope on gp41

PDB Compounds: (L:) Fab Z13e1

SCOPe Domain Sequences for d3fn0l1:

Sequence; same for both SEQRES and ATOM records:

>d3fn0l1 b.1.1.0 (L:3-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eltqspatlslspgeratlscrasqsvgrnlgwyqqkpgqaprlliydasnratgiparf
sgsgsgtdftltisslepedfavyycqarlllpqtfgqgtkveik

Timeline for d3fn0l1:

• d3fn0l1 first appeared in SCOPe 2.03
  
• d3fn0l1 appears in SCOPe 2.04
  
• d3fn0l1 appears in SCOPe 2.06
  
• d3fn0l1 appears in the current release, SCOPe 2.08