![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab 4-4-20 (mouse), kappa L chain [48999] (2 PDB entries) |
![]() | Domain d4fabh2: 4fab H:119-216 [21001] Other proteins in same PDB: d4fabh1, d4fabl1 |
PDB Entry: 4fab (more details), 2.7 Å
SCOP Domain Sequences for d4fabh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fabh2 b.1.1.2 (H:119-216) Immunoglobulin (constant domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkie
Timeline for d4fabh2: