Lineage for d4fabh2 (4fab H:119-216)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8724Species Fab 4-4-20 (mouse), kappa L chain [48999] (2 PDB entries)
  8. 8727Domain d4fabh2: 4fab H:119-216 [21001]
    Other proteins in same PDB: d4fabh1, d4fabl1

Details for d4fabh2

PDB Entry: 4fab (more details), 2.7 Å

PDB Description: three-dimensional structure of a fluorescein-fab complex crystallized in 2-methyl-2,4-pentanediol

SCOP Domain Sequences for d4fabh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4fabh2 b.1.1.2 (H:119-216) Immunoglobulin (constant domains of L and H chains) {Fab 4-4-20 (mouse), kappa L chain}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkie

SCOP Domain Coordinates for d4fabh2:

Click to download the PDB-style file with coordinates for d4fabh2.
(The format of our PDB-style files is described here.)

Timeline for d4fabh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4fabh1