| Class b: All beta proteins [48724] (165 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries) |
| Domain d4fabl2: 4fab L:113-219 [21000] Other proteins in same PDB: d4fabh1, d4fabh2, d4fabl1 part of Fab 4-4-20 complexed with fds, mpd |
PDB Entry: 4fab (more details), 2.7 Å
SCOP Domain Sequences for d4fabl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4fabl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d4fabl2: