Lineage for d1tetl2 (1tet L:108-211)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53955Species Fab TE33 (mouse), kappa L chain [48998] (1 PDB entry)
  8. 53957Domain d1tetl2: 1tet L:108-211 [20996]
    Other proteins in same PDB: d1teth1, d1tetl1

Details for d1tetl2

PDB Entry: 1tet (more details), 2.3 Å

PDB Description: crystal structure of an anticholera toxin peptide complex at 2.3 angstroms

SCOP Domain Sequences for d1tetl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tetl2 b.1.1.2 (L:108-211) Immunoglobulin (constant domains of L and H chains) {Fab TE33 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyewhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1tetl2:

Click to download the PDB-style file with coordinates for d1tetl2.
(The format of our PDB-style files is described here.)

Timeline for d1tetl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1tetl1