Lineage for d3fi9b1 (3fi9 B:1-147)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581220Species Porphyromonas gingivalis [TaxId:431947] [225576] (1 PDB entry)
  8. 1581222Domain d3fi9b1: 3fi9 B:1-147 [209938]
    Other proteins in same PDB: d3fi9a2, d3fi9b2
    automated match to d1hyea1

Details for d3fi9b1

PDB Entry: 3fi9 (more details), 1.9 Å

PDB Description: crystal structure of malate dehydrogenase from porphyromonas gingivalis
PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d3fi9b1:

Sequence, based on SEQRES records: (download)

>d3fi9b1 c.2.1.0 (B:1-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
lsylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegl
nltftsdikealtdakyivssggaprkegmtredllkgnaeiaaqlgkdiksycpdckhv
iiifnpaditglvtliysglkpsqvtt

Sequence, based on observed residues (ATOM records): (download)

>d3fi9b1 c.2.1.0 (B:1-147) automated matches {Porphyromonas gingivalis [TaxId: 431947]}
lsylteekltivgaagmigsnmaqtaammrltpnlclydpfavglegvaeeirhcgfegl
nltftsdikealtdakyivssggtredllkgnaeiaaqlgkdiksycpdckhviiifnpa
ditglvtliysglkpsqvtt

SCOPe Domain Coordinates for d3fi9b1:

Click to download the PDB-style file with coordinates for d3fi9b1.
(The format of our PDB-style files is described here.)

Timeline for d3fi9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fi9b2