SCOPe 2.04: Domain d3fhtb1: 3fht B:75-299

Lineage for d3fhtb1 (3fht B:75-299)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (79 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (95 PDB entries)

8. Domain d3fhtb1: 3fht B:75-299 [209934]
   automated match to d1xtia1
   protein/RNA complex; complexed with anp, gol, mg

Details for d3fhtb1

PDB Entry: 3fht, 2.2 Å

PDB Description: Crystal structure of human Dbp5 in complex with AMPPNP and RNA

PDB Compounds: (B:) ATP-dependent RNA helicase DDX19B

SCOPe Domain Sequences for d3fhtb1:

Sequence, based on SEQRES records:

>d3fhtb1 c.37.1.0 (B:75-299) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
ayavrgnklergqkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghq
dqsiriqrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkr

Sequence, based on observed residues (ATOM records):

>d3fhtb1 c.37.1.0 (B:75-299) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nqvevlqrdpnsplysvksfeelrlkpqllqgvyamgfnrpskiqenalplmlaeppqnl
iaqsqsgtgktaafvlamlsqvepankypqclclsptyelalqtgkvieqmgkfypelkl
ayavrgnkiseqivigtpgtvldwcsklkfidpkkikvfvldeadvmiatqghqdqsiri
qrmlprncqmllfsatfedsvwkfaqkvvpdpnviklkr

Timeline for d3fhtb1:

• d3fhtb1 first appeared in SCOPe 2.03
  
• d3fhtb1 appears in SCOPe 2.05
  
• d3fhtb1 appears in the current release, SCOPe 2.08