SCOP 1.73: Domain d1nbvh2: 1nbv H:123-219

Lineage for d1nbvh2 (1nbv H:123-219)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1nbvh2: 1nbv H:123-219 [20993]
   Other proteins in same PDB: d1nbvh1, d1nbvl1, d1nbvl2
   part of Fab BV04-01

Details for d1nbvh2

PDB Entry: 1nbv, 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

PDB Compounds: (H:) igg2b-kappa bv04-01 fab (heavy chain)

SCOP Domain Sequences for d1nbvh2:

Sequence; same for both SEQRES and ATOM records:

>d1nbvh2 b.1.1.2 (H:123-219) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttppsvyplapgcgdttgssvtlgclvkgyfpesvtvtwnsgslsssvhtfpallqsgl
ytmsssvtvpsstwpsqtvtcsvahpassttvdkkle

Timeline for d1nbvh2:

• d1nbvh2 first appeared (with stable ids) in SCOP 1.55
  
• d1nbvh2 appears in SCOP 1.71
  
• d1nbvh2 appears in SCOP 1.75
  
• d1nbvh2 appears in the current release, SCOPe 2.08