Lineage for d1nbvl2 (1nbv L:113-219)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656331Domain d1nbvl2: 1nbv L:113-219 [20992]
    Other proteins in same PDB: d1nbvh1, d1nbvh2, d1nbvl1
    part of Fab BV04-01

Details for d1nbvl2

PDB Entry: 1nbv (more details), 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex
PDB Compounds: (L:) igg2b-kappa bv04-01 fab (light chain)

SCOP Domain Sequences for d1nbvl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbvl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1nbvl2:

Click to download the PDB-style file with coordinates for d1nbvl2.
(The format of our PDB-style files is described here.)

Timeline for d1nbvl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nbvl1