SCOP 1.65: Domain d1nbvl2: 1nbv L:113-219

Lineage for d1nbvl2 (1nbv L:113-219)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (225 PDB entries)

8. Domain d1nbvl2: 1nbv L:113-219 [20992]
   Other proteins in same PDB: d1nbvh1, d1nbvh2, d1nbvl1
   part of Fab BV04-01

Details for d1nbvl2

PDB Entry: 1nbv, 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1nbvl2:

Sequence; same for both SEQRES and ATOM records:

>d1nbvl2 b.1.1.2 (L:113-219) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1nbvl2:

• d1nbvl2 first appeared (with stable ids) in SCOP 1.55
  
• d1nbvl2 appears in SCOP 1.63
  
• d1nbvl2 appears in SCOP 1.67
  
• d1nbvl2 appears in the current release, SCOPe 2.08