Lineage for d1nbvl2 (1nbv L:113-219)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104099Species Fab BV04-01 (mouse), kappa L chain [48997] (2 PDB entries)
  8. 104101Domain d1nbvl2: 1nbv L:113-219 [20992]
    Other proteins in same PDB: d1nbvh1, d1nbvl1

Details for d1nbvl2

PDB Entry: 1nbv (more details), 2 Å

PDB Description: an autoantibody to single-stranded dna: comparison of the three- dimensional structures of the unliganded fab and a deoxynucleotide- fab complex

SCOP Domain Sequences for d1nbvl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nbvl2 b.1.1.2 (L:113-219) Immunoglobulin (constant domains of L and H chains) {Fab BV04-01 (mouse), kappa L chain}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1nbvl2:

Click to download the PDB-style file with coordinates for d1nbvl2.
(The format of our PDB-style files is described here.)

Timeline for d1nbvl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nbvl1