Lineage for d1mfdh2 (1mfd H:368-468)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160004Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)
  8. 160011Domain d1mfdh2: 1mfd H:368-468 [20991]
    Other proteins in same PDB: d1mfdh1, d1mfdl1

Details for d1mfdh2

PDB Entry: 1mfd (more details), 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdh2:

Sequence, based on SEQRES records: (download)

>d1mfdh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1mfdh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1mfdh2:

Click to download the PDB-style file with coordinates for d1mfdh2.
(The format of our PDB-style files is described here.)

Timeline for d1mfdh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfdh1