SCOP 1.57: Domain d1mfdh2: 1mfd H:368-468

Lineage for d1mfdh2 (1mfd H:368-468)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)

7. Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)

8. Domain d1mfdh2: 1mfd H:368-468 [20991]
   Other proteins in same PDB: d1mfdh1, d1mfdl1

Details for d1mfdh2

PDB Entry: 1mfd, 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdh2:

Sequence, based on SEQRES records:

>d1mfdh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1mfdh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1mfdh2:

• d1mfdh2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfdh2 appears in SCOP 1.59
  
• d1mfdh2 appears in the current release, SCOPe 2.08