Lineage for d3fgma1 (3fgm A:1G-137)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2061457Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 2061458Superfamily b.42.1: Cytokine [50353] (3 families) (S)
  5. 2061459Family b.42.1.1: Fibroblast growth factors (FGF) [50354] (10 proteins)
  6. 2061460Protein Acidic FGF (FGF1) [50357] (4 species)
  7. 2061474Species Human (Homo sapiens) [TaxId:9606] [50359] (94 PDB entries)
    Uniprot P05230 16-152 ! Uniprot P05230
  8. 2061565Domain d3fgma1: 3fgm A:1G-137 [209900]
    Other proteins in same PDB: d3fgma2, d3fgmb2
    automated match to d1q03a_
    complexed with fmt, so4; mutant

Details for d3fgma1

PDB Entry: 3fgm (more details), 1.95 Å

PDB Description: crystal structure of l44f/c83t/c117v/f132w mutant of human acidic fibroblast growth factor
PDB Compounds: (A:) heparin-binding growth factor 1

SCOPe Domain Sequences for d3fgma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fgma1 b.42.1.1 (A:1G-137) Acidic FGF (FGF1) {Human (Homo sapiens) [TaxId: 9606]}
fnlppgnykkpkllycsngghflrilpdgtvdgtrdrsdqhiqfqlsaesvgevyikste
tgqylamdtdgllygsqtpneetlflerleenhyntyiskkhaeknwfvglkkngsvkrg
prthygqkailwlplpv

SCOPe Domain Coordinates for d3fgma1:

Click to download the PDB-style file with coordinates for d3fgma1.
(The format of our PDB-style files is described here.)

Timeline for d3fgma1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3fgma2