SCOP 1.61: Domain d1mfdl2: 1mfd L:112-212

Lineage for d1mfdl2 (1mfd L:112-212)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)

8. Domain d1mfdl2: 1mfd L:112-212 [20990]
   Other proteins in same PDB: d1mfdh1, d1mfdl1

Details for d1mfdl2

PDB Entry: 1mfd, 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdl2:

Sequence; same for both SEQRES and ATOM records:

>d1mfdl2 b.1.1.2 (L:112-212) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsra

Timeline for d1mfdl2:

• d1mfdl2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfdl2 appears in SCOP 1.59
  
• d1mfdl2 appears in SCOP 1.63
  
• d1mfdl2 appears in the current release, SCOPe 2.08