Lineage for d1mfdl2 (1mfd L:112-212)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104381Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)
  8. 104389Domain d1mfdl2: 1mfd L:112-212 [20990]
    Other proteins in same PDB: d1mfdh1, d1mfdl1

Details for d1mfdl2

PDB Entry: 1mfd (more details), 2.1 Å

PDB Description: the solution structure of a trisaccharide-antibody complex: comparison of nmr measurements with a crystal structure

SCOP Domain Sequences for d1mfdl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfdl2 b.1.1.2 (L:112-212) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsra

SCOP Domain Coordinates for d1mfdl2:

Click to download the PDB-style file with coordinates for d1mfdl2.
(The format of our PDB-style files is described here.)

Timeline for d1mfdl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfdl1