Lineage for d1mfch2 (1mfc H:368-468)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 288543Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 289100Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 289192Species Mouse (Mus musculus) [TaxId:10090] [88576] (237 PDB entries)
  8. 289222Domain d1mfch2: 1mfc H:368-468 [20989]
    Other proteins in same PDB: d1mfch1, d1mfcl1, d1mfcl2
    part of Fab SE155-4
    complexed with abe, gal, man, ram

Details for d1mfch2

PDB Entry: 1mfc (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfch2:

Sequence, based on SEQRES records: (download)

>d1mfch2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1mfch2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1mfch2:

Click to download the PDB-style file with coordinates for d1mfch2.
(The format of our PDB-style files is described here.)

Timeline for d1mfch2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfch1