SCOP 1.73: Domain d1mfcl2: 1mfc L:112-212

Lineage for d1mfcl2 (1mfc L:112-212)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)

8. Domain d1mfcl2: 1mfc L:112-212 [20988]
   Other proteins in same PDB: d1mfch1, d1mfch2, d1mfcl1
   part of Fab SE155-4
   complexed with abe, gal, man, ram

Details for d1mfcl2

PDB Entry: 1mfc, 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOP Domain Sequences for d1mfcl2:

Sequence; same for both SEQRES and ATOM records:

>d1mfcl2 b.1.1.2 (L:112-212) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsra

Timeline for d1mfcl2:

• d1mfcl2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfcl2 appears in SCOP 1.71
  
• d1mfcl2 appears in SCOP 1.75
  
• d1mfcl2 appears in the current release, SCOPe 2.08