Class b: All beta proteins [48724] (111 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (6 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species) |
Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries) |
Domain d1mfcl2: 1mfc L:112-212 [20988] Other proteins in same PDB: d1mfch1, d1mfcl1 |
PDB Entry: 1mfc (more details), 2.1 Å
SCOP Domain Sequences for d1mfcl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mfcl2 b.1.1.2 (L:112-212) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain} pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs nnkymassyltltarawerhssyscqvtheghtvekslsra
Timeline for d1mfcl2: