SCOP 1.59: Domain d1mfcl2: 1mfc L:112-212

Lineage for d1mfcl2 (1mfc L:112-212)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)

7. Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)

8. Domain d1mfcl2: 1mfc L:112-212 [20988]
   Other proteins in same PDB: d1mfch1, d1mfcl1

Details for d1mfcl2

PDB Entry: 1mfc, 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfcl2:

Sequence; same for both SEQRES and ATOM records:

>d1mfcl2 b.1.1.2 (L:112-212) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsra

Timeline for d1mfcl2:

• d1mfcl2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfcl2 appears in SCOP 1.57
  
• d1mfcl2 appears in SCOP 1.61
  
• d1mfcl2 appears in the current release, SCOPe 2.08