SCOPe 2.06: Domain d3fefc1: 3fef C:7-171

Lineage for d3fefc1 (3fef C:7-171)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [196388] (11 PDB entries)

8. Domain d3fefc1: 3fef C:7-171 [209878]
   Other proteins in same PDB: d3fefa2, d3fefb2, d3fefc2, d3fefd2
   automated match to d1obba1
   complexed with mg, so4

Details for d3fefc1

PDB Entry: 3fef, 2.2 Å

PDB Description: crystal structure of putative glucosidase lpld from bacillus subtilis

PDB Compounds: (C:) Putative glucosidase lplD, ALPHA-GALACTURONIDASE

SCOPe Domain Sequences for d3fefc1:

Sequence; same for both SEQRES and ATOM records:

>d3fefc1 c.2.1.0 (C:7-171) automated matches {Bacillus subtilis [TaxId: 1423]}
ldqikiayigggsqgwarslmsdlsidermsgtvalydldfeaaqknevignhsgngrwr
yeavstlkkalsaadiviisilpgslddmevdvhlpercgiyqsvgdtvgpggiirglra
vpifaeiarairdyapeswvinytnpmsvctrvlykvfpgikaig

Timeline for d3fefc1:

• d3fefc1 first appeared in SCOPe 2.03
  
• d3fefc1 appears in SCOPe 2.05
  
• d3fefc1 appears in SCOPe 2.07
  
• d3fefc1 appears in the current release, SCOPe 2.08