SCOP 1.73: Domain d1mfeh2: 1mfe H:368-468

Lineage for d1mfeh2 (1mfe H:368-468)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)

8. Domain d1mfeh2: 1mfe H:368-468 [20987]
   Other proteins in same PDB: d1mfeh1, d1mfel1, d1mfel2
   part of Fab SE155-4
   complexed with abe, gal, man

Details for d1mfeh2

PDB Entry: 1mfe, 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

PDB Compounds: (H:) igg1-lambda se155-4 fab (heavy chain)

SCOP Domain Sequences for d1mfeh2:

Sequence, based on SEQRES records:

>d1mfeh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records):

>d1mfeh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Timeline for d1mfeh2:

• d1mfeh2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfeh2 appears in SCOP 1.71
  
• d1mfeh2 appears in SCOP 1.75
  
• d1mfeh2 appears in the current release, SCOPe 2.08