Lineage for d1mfeh2 (1mfe H:368-468)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104381Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)
  8. 104386Domain d1mfeh2: 1mfe H:368-468 [20987]
    Other proteins in same PDB: d1mfeh1, d1mfel1

Details for d1mfeh2

PDB Entry: 1mfe (more details), 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

SCOP Domain Sequences for d1mfeh2:

Sequence, based on SEQRES records: (download)

>d1mfeh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1mfeh2 b.1.1.2 (H:368-468) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
sakttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytl
sssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1mfeh2:

Click to download the PDB-style file with coordinates for d1mfeh2.
(The format of our PDB-style files is described here.)

Timeline for d1mfeh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfeh1