SCOPe 2.06: Domain d3fdub1: 3fdu B:10-249

Lineage for d3fdub1 (3fdu B:10-249)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (54 species)
   not a true protein

7. Species Acinetobacter baumannii [TaxId:400667] [225573] (1 PDB entry)

8. Domain d3fdub1: 3fdu B:10-249 [209865]
   Other proteins in same PDB: d3fdua2, d3fdub2, d3fduc2, d3fdud2
   automated match to d3peaf_
   complexed with gol, so4

Details for d3fdub1

PDB Entry: 3fdu, 2 Å

PDB Description: crystal structure of a putative enoyl-coa hydratase/isomerase from acinetobacter baumannii

PDB Compounds: (B:) Putative enoyl-CoA hydratase/isomerase

SCOPe Domain Sequences for d3fdub1:

Sequence, based on SEQRES records:

>d3fdub1 c.14.1.0 (B:10-249) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdft
agndmkdfmgfvqnpnagpagqvppfvllksaarlskpliiavkgvaigigvtillqadl
vfadntalfqipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvne
ivedayataqataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspemle

Sequence, based on observed residues (ATOM records):

>d3fdub1 c.14.1.0 (B:10-249) automated matches {Acinetobacter baumannii [TaxId: 400667]}
hphlnanleggvltlainrpeaknalygelylwiakaldeadqnkdvrvvvlrgaehdft
agndmkdfmpagqvppfvllksaarlskpliiavkgvaigigvtillqadlvfadntalf
qipfvslglspeggasqllvkqagyhkaaellftakkfnaetalqaglvneivedayata
qataqhltalplaslkqtkalmkhdldqiiecidheaeifmqrvqspemle

Timeline for d3fdub1:

• d3fdub1 first appeared in SCOPe 2.03, called d3fdub_
  
• d3fdub1 was called d3fdub_ in SCOPe 2.05
  
• d3fdub1 appears in SCOPe 2.07
  
• d3fdub1 appears in the current release, SCOPe 2.08