SCOPe 2.02: Domain d1mfel2: 1mfe L:112-211

Lineage for d1mfel2 (1mfe L:112-211)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin light chain lambda constant domain, CL-lambda [88570] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88571] (21 PDB entries)
   Uniprot Q8N355 20-230 # 94% sequence identity; natural chimera: antibody light chain (Fab HYB3)

8. Domain d1mfel2: 1mfe L:112-211 [20986]
   Other proteins in same PDB: d1mfeh1, d1mfeh2, d1mfel1
   part of Fab SE155-4

Details for d1mfel2

PDB Entry: 1mfe, 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

PDB Compounds: (L:) igg1-lambda se155-4 fab (light chain)

SCOPe Domain Sequences for d1mfel2:

Sequence; same for both SEQRES and ATOM records:

>d1mfel2 b.1.1.2 (L:112-211) Immunoglobulin light chain lambda constant domain, CL-lambda {Mouse (Mus musculus) [TaxId: 10090]}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsr

Timeline for d1mfel2:

• d1mfel2 first appeared (with stable ids) in SCOP 1.55
  
• d1mfel2 appears in SCOPe 2.01
  
• d1mfel2 appears in SCOPe 2.03
  
• d1mfel2 appears in the current release, SCOPe 2.08