Lineage for d1mfel2 (1mfe L:112-211)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160004Species Fab SE155-4 (mouse), lambda L chain [48996] (4 PDB entries)
  8. 160010Domain d1mfel2: 1mfe L:112-211 [20986]
    Other proteins in same PDB: d1mfeh1, d1mfel1

Details for d1mfel2

PDB Entry: 1mfe (more details), 2 Å

PDB Description: recognition of a cell-surface oligo-saccharide of pathogenic salmonella by an antibody fab fragment

SCOP Domain Sequences for d1mfel2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mfel2 b.1.1.2 (L:112-211) Immunoglobulin (constant domains of L and H chains) {Fab SE155-4 (mouse), lambda L chain}
pksspsvtlfppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqs
nnkymassyltltarawerhssyscqvtheghtvekslsr

SCOP Domain Coordinates for d1mfel2:

Click to download the PDB-style file with coordinates for d1mfel2.
(The format of our PDB-style files is described here.)

Timeline for d1mfel2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfel1