SCOPe 2.03: Domain d3fcph1: 3fcp H:3-131

Lineage for d3fcph1 (3fcp H:3-131)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [225571] (1 PDB entry)

8. Domain d3fcph1: 3fcp H:3-131 [209858]
   Other proteins in same PDB: d3fcpa2, d3fcpb2, d3fcpc2, d3fcpd2, d3fcpe2, d3fcpf2, d3fcpg2, d3fcph2
   automated match to d1f9ca2
   complexed with mg

Details for d3fcph1

PDB Entry: 3fcp, 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae

PDB Compounds: (H:) L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme

SCOPe Domain Sequences for d3fcph1:

Sequence, based on SEQRES records:

>d3fcph1 d.54.1.0 (H:3-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ltatveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsygv
espeaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalg
lpvsallgg

Sequence, based on observed residues (ATOM records):

>d3fcph1 d.54.1.0 (H:3-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
ltatveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissait
hyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallgg

Timeline for d3fcph1:

• d3fcph1 is new in SCOPe 2.03-stable
  
• d3fcph1 appears in SCOPe 2.04
  
• d3fcph1 appears in the current release, SCOPe 2.08