SCOPe 2.03: Domain d3fcpg2: 3fcp G:132-373

Lineage for d3fcpg2 (3fcp G:132-373)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (45 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:272620] [225572] (1 PDB entry)

8. Domain d3fcpg2: 3fcp G:132-373 [209857]
   Other proteins in same PDB: d3fcpa1, d3fcpb1, d3fcpc1, d3fcpd1, d3fcpe1, d3fcpf1, d3fcpg1, d3fcph1
   automated match to d1f9ca1
   complexed with mg

Details for d3fcpg2

PDB Entry: 3fcp, 1.8 Å

PDB Description: crystal structure of muconate lactonizing enzyme from klebsiella pneumoniae

PDB Compounds: (G:) L-Ala-D/L-Glu epimerase, a muconate lactonizing enzyme

SCOPe Domain Sequences for d3fcpg2:

Sequence, based on SEQRES records:

>d3fcpg2 c.1.11.0 (G:132-373) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
alqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdlrhtraivealg
drasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailade
avataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtv
aslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfyt
rq

Sequence, based on observed residues (ATOM records):

>d3fcpg2 c.1.11.0 (G:132-373) automated matches {Klebsiella pneumoniae [TaxId: 272620]}
alqtalpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdras
irvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavat
aydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslh
awstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq

Timeline for d3fcpg2:

• d3fcpg2 is new in SCOPe 2.03-stable
  
• d3fcpg2 appears in SCOPe 2.04
  
• d3fcpg2 appears in the current release, SCOPe 2.08