Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
Protein automated matches [226923] (45 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [225572] (1 PDB entry) |
Domain d3fcpg2: 3fcp G:132-373 [209857] Other proteins in same PDB: d3fcpa1, d3fcpb1, d3fcpc1, d3fcpd1, d3fcpe1, d3fcpf1, d3fcpg1, d3fcph1 automated match to d1f9ca1 complexed with mg |
PDB Entry: 3fcp (more details), 1.8 Å
SCOPe Domain Sequences for d3fcpg2:
Sequence, based on SEQRES records: (download)
>d3fcpg2 c.1.11.0 (G:132-373) automated matches {Klebsiella pneumoniae [TaxId: 272620]} alqtalpvlwtlasgdtakdiaegekllaegrhrafklkigarelatdlrhtraivealg drasirvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailade avataydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtv aslhawstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfyt rq
>d3fcpg2 c.1.11.0 (G:132-373) automated matches {Klebsiella pneumoniae [TaxId: 272620]} alqtalpvlwtlasgdtakdiaegekllarafklkigarelatdlrhtraivealgdras irvdvnqawdaatgakgcrelaamgvdlieqpvsahdnaalvrlsqqietailadeavat aydgyqlaqqgftgayalkiakaggpnsvlalarvaqaagiglyggtmlegtvgtvaslh awstlplqwgtemfgplllkddivsvpltfadgqvalpqtpglgveldedklhfytrq
Timeline for d3fcpg2: