Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (88 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:272620] [225571] (1 PDB entry) |
Domain d3fcpf1: 3fcp F:5-131 [209854] Other proteins in same PDB: d3fcpa2, d3fcpa3, d3fcpb2, d3fcpc2, d3fcpd2, d3fcpe2, d3fcpf2, d3fcpg2, d3fcph2, d3fcph3 automated match to d1f9ca2 complexed with mg |
PDB Entry: 3fcp (more details), 1.8 Å
SCOPe Domain Sequences for d3fcpf1:
Sequence, based on SEQRES records: (download)
>d3fcpf1 d.54.1.0 (F:5-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]} atveqieswivdvptirphklsmttmgcqslvivrltrsdgicgigeattigglsygves peaissaithyltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglp vsallgg
>d3fcpf1 d.54.1.0 (F:5-131) automated matches {Klebsiella pneumoniae [TaxId: 272620]} atveqieswivdvpticqslvivrltrsdgicgigeattigglsygvespeaissaithy ltpllkgqpadnlnaltarmngaikgntfaksaietalldaqgkalglpvsallgg
Timeline for d3fcpf1: