Lineage for d1mfbh2 (1mfb H:368-468)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549236Domain d1mfbh2: 1mfb H:368-468 [20985]
    Other proteins in same PDB: d1mfbh1, d1mfbl1, d1mfbl2
    part of Fab SE155-4
    complexed with abe, gal, man, ram

Details for d1mfbh2

PDB Entry: 1mfb (more details), 2.1 Å

PDB Description: high resolution structures of antibody fab fragment complexed with cell-surface oligosaccharide of pathogenic salmonella

SCOP Domain Sequences for d1mfbh2:

Sequence, based on SEQRES records: (download)

>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsaaqtdsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs
dlytlsssvtvpsstwpsetvtcnvahpasstkvdkkivpr

Sequence, based on observed residues (ATOM records): (download)

>d1mfbh2 b.1.1.2 (H:368-468) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
sakttppsvyplapgsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
ssvtvpsstwpsetvtcnvahpasstkvdkkivpr

SCOP Domain Coordinates for d1mfbh2:

Click to download the PDB-style file with coordinates for d1mfbh2.
(The format of our PDB-style files is described here.)

Timeline for d1mfbh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mfbh1